Recombinant Chicken Low-density lipoprotein receptor-related protein 1 (LRP1), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cancer
Uniprot ID: P98157
Gene Names: LRP1
Alternative Name(s): LRP-1;Alpha-2-macroglobulin receptor;A2MR
Abbreviation: Recombinant Chicken LRP1 protein, partial
Organism: Gallus gallus (Chicken)
Source: Mammalian cell
Expression Region: 27-336aa
Protein Length: Partial
Tag Info: C-terminal hFc1-tagged
Target Protein Sequence: KTCSPKQFACKDQITCISKGWRCDGEKDCPDGSDESPDICPQSKVSRCQPNEHNCLGTELCIHMSKLCNGLHDCFDGSDEGPHCREQLANCTALGCQHHCVPTLSGPACYCNNSFQLAEDRRSCKDFDECTVYGTCSQTCTNTEGSYTCSCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAPVPNITPTSAKQTTAMDFNYIEDTVCWVHVGDSASQTILKCAKIPNLKGFVEERSINISLSLHQVEQMAIDWLTGNFYFVDDIDDRIFVCNKNGLTCVTLLDLELYNPKGIALDPAM
MW: 63.0 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Acts as an alpha-2-macroglobulin receptor.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Chicken Low-density lipoprotein receptor-related protein 1 (LRP1), partial
Recombinant Chicken Low-density lipoprotein receptor-related protein 1 (LRP1), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cancer
Uniprot ID: P98157
Gene Names: LRP1
Alternative Name(s): LRP-1;Alpha-2-macroglobulin receptor;A2MR
Abbreviation: Recombinant Chicken LRP1 protein, partial
Organism: Gallus gallus (Chicken)
Source: Mammalian cell
Expression Region: 27-336aa
Protein Length: Partial
Tag Info: C-terminal hFc1-tagged
Target Protein Sequence: KTCSPKQFACKDQITCISKGWRCDGEKDCPDGSDESPDICPQSKVSRCQPNEHNCLGTELCIHMSKLCNGLHDCFDGSDEGPHCREQLANCTALGCQHHCVPTLSGPACYCNNSFQLAEDRRSCKDFDECTVYGTCSQTCTNTEGSYTCSCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAPVPNITPTSAKQTTAMDFNYIEDTVCWVHVGDSASQTILKCAKIPNLKGFVEERSINISLSLHQVEQMAIDWLTGNFYFVDDIDDRIFVCNKNGLTCVTLLDLELYNPKGIALDPAM
MW: 63.0 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Acts as an alpha-2-macroglobulin receptor.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cancer
Uniprot ID: P98157
Gene Names: LRP1
Alternative Name(s): LRP-1;Alpha-2-macroglobulin receptor;A2MR
Abbreviation: Recombinant Chicken LRP1 protein, partial
Organism: Gallus gallus (Chicken)
Source: Mammalian cell
Expression Region: 27-336aa
Protein Length: Partial
Tag Info: C-terminal hFc1-tagged
Target Protein Sequence: KTCSPKQFACKDQITCISKGWRCDGEKDCPDGSDESPDICPQSKVSRCQPNEHNCLGTELCIHMSKLCNGLHDCFDGSDEGPHCREQLANCTALGCQHHCVPTLSGPACYCNNSFQLAEDRRSCKDFDECTVYGTCSQTCTNTEGSYTCSCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAPVPNITPTSAKQTTAMDFNYIEDTVCWVHVGDSASQTILKCAKIPNLKGFVEERSINISLSLHQVEQMAIDWLTGNFYFVDDIDDRIFVCNKNGLTCVTLLDLELYNPKGIALDPAM
MW: 63.0 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Acts as an alpha-2-macroglobulin receptor.
Reference:
Function:











