Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83508
Gene Names: Lcncavp2
Alternative Name(s): Major allergen Cav p 2;allergen Cav p 2.0101
Abbreviation: Recombinant Guinea pig Lcncavp2 protein
Organism: Cavia porcellus (Guinea pig)
Source: E.coli
Expression Region: 17-170aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: DSIDYSKVPGNWRTIAIAADHVEKIEVNGELRAYFRQVDCTEGCDKISITFYTNTDGVCTEHTVVGARNGENDVYTVDYAGENTFQILCNSDDAFVIGSVNTDQNGQTTKEVAIAAKRNFLTPEQEQKFQKAVQNAGIPLENIRYVIETDTCPD
MW: 24 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)
Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83508
Gene Names: Lcncavp2
Alternative Name(s): Major allergen Cav p 2;allergen Cav p 2.0101
Abbreviation: Recombinant Guinea pig Lcncavp2 protein
Organism: Cavia porcellus (Guinea pig)
Source: E.coli
Expression Region: 17-170aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: DSIDYSKVPGNWRTIAIAADHVEKIEVNGELRAYFRQVDCTEGCDKISITFYTNTDGVCTEHTVVGARNGENDVYTVDYAGENTFQILCNSDDAFVIGSVNTDQNGQTTKEVAIAAKRNFLTPEQEQKFQKAVQNAGIPLENIRYVIETDTCPD
MW: 24 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:
Original: $85,431.64
-70%$85,431.64
$25,629.49Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83508
Gene Names: Lcncavp2
Alternative Name(s): Major allergen Cav p 2;allergen Cav p 2.0101
Abbreviation: Recombinant Guinea pig Lcncavp2 protein
Organism: Cavia porcellus (Guinea pig)
Source: E.coli
Expression Region: 17-170aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: DSIDYSKVPGNWRTIAIAADHVEKIEVNGELRAYFRQVDCTEGCDKISITFYTNTDGVCTEHTVVGARNGENDVYTVDYAGENTFQILCNSDDAFVIGSVNTDQNGQTTKEVAIAAKRNFLTPEQEQKFQKAVQNAGIPLENIRYVIETDTCPD
MW: 24 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference:
Function:











