HomeStore

Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)

Product image 1

Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)

Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P03237

Gene Names: PH

Alternative Name(s): Major occlusion protein

Abbreviation: Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin protein

Organism: Bombyx mori nuclear polyhedrosis virus (BmNPV)

Source: E.coli

Expression Region: 2-245aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: PNYSYNPTIGRTYVYDNKYYKNLGGLIKNAKRKKHLIEHEKEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEVRNVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWDEDYVPHEVIRIMEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAPLFTGPAY

MW: 35.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Major component of the virus occlusion bodies, which are large proteinaceous structures polyhedra, that protect the virus from the outside environment for extended periods until they are ingested by insect larvae.

Reference:

Function:

$794.32

Original: $2,647.73

-70%
Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)

$2,647.73

$794.32

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P03237

Gene Names: PH

Alternative Name(s): Major occlusion protein

Abbreviation: Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin protein

Organism: Bombyx mori nuclear polyhedrosis virus (BmNPV)

Source: E.coli

Expression Region: 2-245aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: PNYSYNPTIGRTYVYDNKYYKNLGGLIKNAKRKKHLIEHEKEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEVRNVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWDEDYVPHEVIRIMEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAPLFTGPAY

MW: 35.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Major component of the virus occlusion bodies, which are large proteinaceous structures polyhedra, that protect the virus from the outside environment for extended periods until they are ingested by insect larvae.

Reference:

Function:

You may also like

-70%NEW
Thumbnail 1

Phi29 DNA Polymerase

$96.90

$29.07

-70%NEW
Thumbnail 1Thumbnail 2

Disposable Sampling Swab-Nasal Swab

$12,173.46

$3,652.04

-70%NEW
Thumbnail 1

Horse Cystic fibrosis transmembrane conductance regulator (CFTR) ELISA Kit

$100,503.55

$30,151.06

-70%NEW
Thumbnail 1

Sheep anti-human C-Reactive Protein (CRP) PolyClonal antibody (Copy)

$52,461.84

$15,738.55

NEW

TransNGS® 384 UDI Indexed Adapter Kit for Illumina®

$48,693.86

-70%NEW

TransNGS® UDI Indexed Adapter Kit for Illumina®

$19,492.04

$5,847.61

NEW
Thumbnail 1

Mouse Tbkbp1/ TANK-binding kinase 1-binding protein 1 ELISA Kit

$97,822.49

NEW
Thumbnail 1

Pig FGA/ Fibrinogen alpha chain ELISA Kit

$113,401.62

-70%NEW
Thumbnail 1

Chicken GAL/ Galanin ELISA Kit

$113,401.62

$34,020.49

-70%NEW
Thumbnail 1

Human MYDGF/ Myeloid-derived growth factor ELISA Kit

$92,750.21

$27,825.06

NEW
Thumbnail 1

Rat Ugt1a8/ UDP-glucuronosyltransferase 1-8 ELISA Kit

$100,358.62

-70%NEW
Thumbnail 1

Human LTA4H/ Leukotriene A-4 hydrolase ELISA Kit

$92,750.21

$27,825.06