HomeStore

Recombinant Blomia tropicalis Major allergen Blo t 12

Product image 1

Recombinant Blomia tropicalis Major allergen Blo t 12

Recombinant Blomia tropicalis Major allergen Blo t 12

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q17282

Gene Names: N/A

Alternative Name(s): (allergen Blo t 12)

Abbreviation: Recombinant Blomia tropicalis Major allergen Blo t 12 protein

Organism: Blomia tropicalis (Mite)

Source: E.coli

Expression Region: 21-144aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: ADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISRNCVLDN

MW: 18.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "Nucleotide sequence analysis of a complementary DNA coding for a Blomia tropicalis allergen." Puerta L., Caraballo L., Fernandez-Caldas E., Avjioglu A., Marsh D.G., Lockey R.F., Dao M.L. J. Allergy Clin. Immunol. 98: 932-937(1996)

Function:

$619.51
Recombinant Blomia tropicalis Major allergen Blo t 12
$619.51

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q17282

Gene Names: N/A

Alternative Name(s): (allergen Blo t 12)

Abbreviation: Recombinant Blomia tropicalis Major allergen Blo t 12 protein

Organism: Blomia tropicalis (Mite)

Source: E.coli

Expression Region: 21-144aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: ADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISRNCVLDN

MW: 18.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "Nucleotide sequence analysis of a complementary DNA coding for a Blomia tropicalis allergen." Puerta L., Caraballo L., Fernandez-Caldas E., Avjioglu A., Marsh D.G., Lockey R.F., Dao M.L. J. Allergy Clin. Immunol. 98: 932-937(1996)

Function: