Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q38504
Gene Names: 5
Alternative Name(s): SSB;Gene product 5;gp5;Protein p5
Abbreviation: Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein
Organism: Bacillus phage phi29 (Bacteriophage phi-29)
Source: E.coli
Expression Region: 1-124aa
Protein Length: Full Length
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: MENTNIVKATFDTETLEGQIKIFNAQTGGGQSFKNLPDGTIIEANAIAQYKQVSDTYGDAKEETVTTIFAADGSLYSAISKTVAEAASDLIDLVTRHKLETFKVKVVQGTSSKGNVFFSLQLSL
MW: 20.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Single-stranded DNA binding protein required for the elongation during viral DNA replication by strand displacement. Displaced viral DNA strands are transiently coated with the ssDNA-binding protein and therefore protected against nucleases. The latter is then probably removed by the replisome that performs lagging strand synthesis or during the events that lead up to the recombination process. Stimulates in vitro DNA replication several fold. Has helix-destabilizing activity since it removes secondary structure from the ssDNA in replicative intermediates.
Reference:
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)
Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q38504
Gene Names: 5
Alternative Name(s): SSB;Gene product 5;gp5;Protein p5
Abbreviation: Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein
Organism: Bacillus phage phi29 (Bacteriophage phi-29)
Source: E.coli
Expression Region: 1-124aa
Protein Length: Full Length
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: MENTNIVKATFDTETLEGQIKIFNAQTGGGQSFKNLPDGTIIEANAIAQYKQVSDTYGDAKEETVTTIFAADGSLYSAISKTVAEAASDLIDLVTRHKLETFKVKVVQGTSSKGNVFFSLQLSL
MW: 20.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Single-stranded DNA binding protein required for the elongation during viral DNA replication by strand displacement. Displaced viral DNA strands are transiently coated with the ssDNA-binding protein and therefore protected against nucleases. The latter is then probably removed by the replisome that performs lagging strand synthesis or during the events that lead up to the recombination process. Stimulates in vitro DNA replication several fold. Has helix-destabilizing activity since it removes secondary structure from the ssDNA in replicative intermediates.
Reference:
Function:
Original: $12,086,511.48
-70%$12,086,511.48
$3,625,953.44Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q38504
Gene Names: 5
Alternative Name(s): SSB;Gene product 5;gp5;Protein p5
Abbreviation: Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein
Organism: Bacillus phage phi29 (Bacteriophage phi-29)
Source: E.coli
Expression Region: 1-124aa
Protein Length: Full Length
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: MENTNIVKATFDTETLEGQIKIFNAQTGGGQSFKNLPDGTIIEANAIAQYKQVSDTYGDAKEETVTTIFAADGSLYSAISKTVAEAASDLIDLVTRHKLETFKVKVVQGTSSKGNVFFSLQLSL
MW: 20.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Single-stranded DNA binding protein required for the elongation during viral DNA replication by strand displacement. Displaced viral DNA strands are transiently coated with the ssDNA-binding protein and therefore protected against nucleases. The latter is then probably removed by the replisome that performs lagging strand synthesis or during the events that lead up to the recombination process. Stimulates in vitro DNA replication several fold. Has helix-destabilizing activity since it removes secondary structure from the ssDNA in replicative intermediates.
Reference:
Function:











