HomeStore

Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b)

Product image 1

Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b)

Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b)

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q80RZ3

Gene Names: 5b

Alternative Name(s): (ns5b)(Accessory protein 5b)

Abbreviation: Recombinant Avian infectious bronchitis virus Non-structural protein 5b

Organism: Avian infectious bronchitis virus (strain M41) (IBV)

Source: E.coli

Expression Region: 1-82aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MNNSKDNPFCGAIARKARIYLREGLDCVYFLNKAGQAESCPACTSLVFQGKTCEEHKYNNNLLSWQAVRQLERQMPQLQSSN

MW: 11.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Involved in host translation shutoff without degradating host RNA. By suppressing host gene expression, facilitates the evasion from host type I interferon immune response.

Reference: "Infectious Bronchitis Coronavirus Limits Interferon Production by Inducing a Host Shutoff That Requires Accessory Protein 5b." Kint J., Langereis M.A., Maier H.J., Britton P., van Kuppeveld F.J., Koumans J., Wiegertjes G.F., Forlenza M. J. Virol. 90: 7519-7528(2016)

Function:

$269.40

Original: $898.01

-70%
Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b)

$898.01

$269.40

Product Information

Shipping & Returns

Description

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q80RZ3

Gene Names: 5b

Alternative Name(s): (ns5b)(Accessory protein 5b)

Abbreviation: Recombinant Avian infectious bronchitis virus Non-structural protein 5b

Organism: Avian infectious bronchitis virus (strain M41) (IBV)

Source: E.coli

Expression Region: 1-82aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MNNSKDNPFCGAIARKARIYLREGLDCVYFLNKAGQAESCPACTSLVFQGKTCEEHKYNNNLLSWQAVRQLERQMPQLQSSN

MW: 11.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Involved in host translation shutoff without degradating host RNA. By suppressing host gene expression, facilitates the evasion from host type I interferon immune response.

Reference: "Infectious Bronchitis Coronavirus Limits Interferon Production by Inducing a Host Shutoff That Requires Accessory Protein 5b." Kint J., Langereis M.A., Maier H.J., Britton P., van Kuppeveld F.J., Koumans J., Wiegertjes G.F., Forlenza M. J. Virol. 90: 7519-7528(2016)

Function: