Recombinant Aquifex aeolicus Reverse gyrase 2 (rgy2), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: O67226
Gene Names: rgy2
Alternative Name(s): (Helicase)(Topoisomerase)
Abbreviation: Recombinant Aquifex aeolicus rgy2 protein, partial
Organism: Aquifex aeolicus (strain VF5)
Source: E.coli
Expression Region: 1-280aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MALELIERGCPNCGGVISSDRLEKGLPCSKCLPKPTEEKVCDALEELKTLKYLKPFCDTDKSLERFINFFEKAVGAKPWSLQRVWAKRVFMNQSFAIVAPTGVGKTTFGLVMSLFLKGRVLAIFPTRLLAQQAGDRLSELAQKVGVNKKILIYQSKKNIREQFLNGDWDILLGTNMFLHKNFENLINFKFKLIFIDDIDSFLKRGKNVDYLFKLLGFSGEEIKLALKENKTQRDYDRLARIRKRKRDTVLIVSSATLKPRGKRAYLFRNLLGFDVQKAIT
MW: 39.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Reference: "Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11: 171-176(1986)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Aquifex aeolicus Reverse gyrase 2 (rgy2), partial
Recombinant Aquifex aeolicus Reverse gyrase 2 (rgy2), partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: O67226
Gene Names: rgy2
Alternative Name(s): (Helicase)(Topoisomerase)
Abbreviation: Recombinant Aquifex aeolicus rgy2 protein, partial
Organism: Aquifex aeolicus (strain VF5)
Source: E.coli
Expression Region: 1-280aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MALELIERGCPNCGGVISSDRLEKGLPCSKCLPKPTEEKVCDALEELKTLKYLKPFCDTDKSLERFINFFEKAVGAKPWSLQRVWAKRVFMNQSFAIVAPTGVGKTTFGLVMSLFLKGRVLAIFPTRLLAQQAGDRLSELAQKVGVNKKILIYQSKKNIREQFLNGDWDILLGTNMFLHKNFENLINFKFKLIFIDDIDSFLKRGKNVDYLFKLLGFSGEEIKLALKENKTQRDYDRLARIRKRKRDTVLIVSSATLKPRGKRAYLFRNLLGFDVQKAIT
MW: 39.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Reference: "Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11: 171-176(1986)
Function:
Original: $85,431.64
-70%$85,431.64
$25,629.49Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: O67226
Gene Names: rgy2
Alternative Name(s): (Helicase)(Topoisomerase)
Abbreviation: Recombinant Aquifex aeolicus rgy2 protein, partial
Organism: Aquifex aeolicus (strain VF5)
Source: E.coli
Expression Region: 1-280aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MALELIERGCPNCGGVISSDRLEKGLPCSKCLPKPTEEKVCDALEELKTLKYLKPFCDTDKSLERFINFFEKAVGAKPWSLQRVWAKRVFMNQSFAIVAPTGVGKTTFGLVMSLFLKGRVLAIFPTRLLAQQAGDRLSELAQKVGVNKKILIYQSKKNIREQFLNGDWDILLGTNMFLHKNFENLINFKFKLIFIDDIDSFLKRGKNVDYLFKLLGFSGEEIKLALKENKTQRDYDRLARIRKRKRDTVLIVSSATLKPRGKRAYLFRNLLGFDVQKAIT
MW: 39.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Reference: "Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11: 171-176(1986)
Function:











