Recombinant Apis mellifera Alpha-glucosidase, partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Alpha-glucosidase
Uniprot ID: Q17058
Gene Names: N/A
Alternative Name(s): (Maltase)
Abbreviation: Recombinant Apis mellifera Alpha-glucosidase protein, partial
Organism: Apis mellifera (Honeybee)
Source: E.coli
Expression Region: 18-420aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: AWKPLPENLKEDLIVYQVYPRSFKDSNGDGIGDIEGIKEKLDHFLEMGVDMFWLSPIYPSPMVDFGYDISNYTDVHPIFGTISDLDNLVSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYYIWHPGKIVNGKRVPPTNWVGVFGGSAWSWREERQAYYLHQFAPEQPDLNYYNPVVLDDMQNVLRFWLRRGFDGFRVDALPYICEDMRFLDEPLSGETNDPNKTEYTLKIYTHDIPETYNVVRKFRDVLDEFPQPKHMLIEAYTNLSMTMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLVDNWMTYMPPSGIPNWVPGNHDQLRLVSRFGEEKARMITTMSLLLPGVAVNYYGDEIGMSDTYISWEDTQDPQGCGAGKENYQTMSRDPARTPF
MW: 54.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Converts sucrose in nectar to glucose and fructose.
Reference: "Molecular cloning of cDNA and analysis of expression of the gene for alpha-glucosidase from the hypopharyngeal gland of the honeybee apis mellifera L." Ohashi K., Sawata M., Takeuchi H., Natori S., Kubo T. Biochem. Biophys. Res. Commun. 221: 380-385(1996)
Function:
Product Information
Product Information
Shipping & Returns
Shipping & Returns

Recombinant Apis mellifera Alpha-glucosidase, partial
Recombinant Apis mellifera Alpha-glucosidase, partial
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Alpha-glucosidase
Uniprot ID: Q17058
Gene Names: N/A
Alternative Name(s): (Maltase)
Abbreviation: Recombinant Apis mellifera Alpha-glucosidase protein, partial
Organism: Apis mellifera (Honeybee)
Source: E.coli
Expression Region: 18-420aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: AWKPLPENLKEDLIVYQVYPRSFKDSNGDGIGDIEGIKEKLDHFLEMGVDMFWLSPIYPSPMVDFGYDISNYTDVHPIFGTISDLDNLVSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYYIWHPGKIVNGKRVPPTNWVGVFGGSAWSWREERQAYYLHQFAPEQPDLNYYNPVVLDDMQNVLRFWLRRGFDGFRVDALPYICEDMRFLDEPLSGETNDPNKTEYTLKIYTHDIPETYNVVRKFRDVLDEFPQPKHMLIEAYTNLSMTMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLVDNWMTYMPPSGIPNWVPGNHDQLRLVSRFGEEKARMITTMSLLLPGVAVNYYGDEIGMSDTYISWEDTQDPQGCGAGKENYQTMSRDPARTPF
MW: 54.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Converts sucrose in nectar to glucose and fructose.
Reference: "Molecular cloning of cDNA and analysis of expression of the gene for alpha-glucosidase from the hypopharyngeal gland of the honeybee apis mellifera L." Ohashi K., Sawata M., Takeuchi H., Natori S., Kubo T. Biochem. Biophys. Res. Commun. 221: 380-385(1996)
Function:
Original: $619.51
-70%$619.51
$185.85Product Information
Product Information
Shipping & Returns
Shipping & Returns
Description
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Alpha-glucosidase
Uniprot ID: Q17058
Gene Names: N/A
Alternative Name(s): (Maltase)
Abbreviation: Recombinant Apis mellifera Alpha-glucosidase protein, partial
Organism: Apis mellifera (Honeybee)
Source: E.coli
Expression Region: 18-420aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: AWKPLPENLKEDLIVYQVYPRSFKDSNGDGIGDIEGIKEKLDHFLEMGVDMFWLSPIYPSPMVDFGYDISNYTDVHPIFGTISDLDNLVSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYYIWHPGKIVNGKRVPPTNWVGVFGGSAWSWREERQAYYLHQFAPEQPDLNYYNPVVLDDMQNVLRFWLRRGFDGFRVDALPYICEDMRFLDEPLSGETNDPNKTEYTLKIYTHDIPETYNVVRKFRDVLDEFPQPKHMLIEAYTNLSMTMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLVDNWMTYMPPSGIPNWVPGNHDQLRLVSRFGEEKARMITTMSLLLPGVAVNYYGDEIGMSDTYISWEDTQDPQGCGAGKENYQTMSRDPARTPF
MW: 54.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Converts sucrose in nectar to glucose and fructose.
Reference: "Molecular cloning of cDNA and analysis of expression of the gene for alpha-glucosidase from the hypopharyngeal gland of the honeybee apis mellifera L." Ohashi K., Sawata M., Takeuchi H., Natori S., Kubo T. Biochem. Biophys. Res. Commun. 221: 380-385(1996)
Function:











